vidgrids.com : Online Video Search & Discovery Engine :

1950s Lamp Videos

Bargain Hunt Australia - 1950s Swivel Desk Lamp
Bargain Hunt Australia - 1950s Swivel Desk Lamp

Bargain Hunt is © BBC Television Find out more and watch episodes online at http://bbc.co.uk/programmes/b006nb9z.

Film footage about Lamp Construction Inc. Elgin, IL from the 1950s
Film footage about Lamp Construction Inc. Elgin, IL from the 1950s

This is a short film about Lamp Construction Inc. Elgin, IL from the 1950s. Founded by Clifford E. Lamp. They began with home construction and remodeling and then branched into industrial and...

1950s Daydream Twin-Lite bed lamp
1950s Daydream Twin-Lite bed lamp

My nice pastel green 1950s "DAYDREAM TWIN-LITE" double bed lamp, which I found in an antique shop in Canberra.

Old 1950's "Mid Century Modern" Desk Lamp
Old 1950's "Mid Century Modern" Desk Lamp

An old 1950's desk lamp I use to light my videos - seems I've had it forever. Has a picture hanger under the base for wall mounting - not very stable though, tried that for a couple of months...

Atomic Lamp - Circa 1950's
Atomic Lamp - Circa 1950's

Showing vintage items Here is an atomic lamp from the 1950's with a fiberglass string or spaghetti shade. 2 "Ross" items he was a popular name in the household in the 50's.

1950s National Fluorescent Lamp FS-193
1950s National Fluorescent Lamp FS-193

A $10 score from a thrift shop.

Antique Italian 1950s "PHANTOM" design chrome floor lamp
Antique Italian 1950s "PHANTOM" design chrome floor lamp

http://newel.com/PreviewImage.aspx?ItemID=13959 - Newel.com: Antique Italian 1950s "PHANTOM" design chrome floor lamp with 4 various height columns eminating from a round base holding ...

VINTAGE MID CENTURY MODERN 1950's GOLD OVAL SHADE BRASS TABLE LAMP
VINTAGE MID CENTURY MODERN 1950's GOLD OVAL SHADE BRASS TABLE LAMP

VINTAGE MID CENTURY MODERN 1950's GOLD OVAL SHADE BRASS TABLE LAMP Thank you for watching Visit us at http://SMILEatTheDEALS.com Add us on Facebook ...

1950's lamp
1950's lamp

I'm definitely one who appreciates style and boy did the 50's have style!! Types included atomic, Eames, Danish Modern. We use terms now such as mid-century modern and retro. Regardless,...

Retro 1950s Chinese Lantern motion TV lamp
Retro 1950s Chinese Lantern motion TV lamp

Available now at sky-parlor - search for us on eBay.

Antique American 1950s gold painted iron table lamp with
Antique American 1950s gold painted iron table lamp with

http://newel.com/PreviewImage.aspx?ItemID=13592 - Newel.com: Antique American 1950s gold painted iron table lamp with triple scroll design base (Art Moderne/1940s, American, lighting, table.

1950'S Era Retro Motion Lamp ~ "Fountain Of Youth
1950'S Era Retro Motion Lamp ~ "Fountain Of Youth

This fun 50's Motion Light from Econolite revolves to show a young boy "peeing" in the stream with a frog croaking nearby. The opposite side of light covers reveals Ponce de Leon with Indian...

VINTAGE MID CENTURY 1950's GOLD BRASS RETRACTABLE CEILING LAMP SAUCER EAMES ERA
VINTAGE MID CENTURY 1950's GOLD BRASS RETRACTABLE CEILING LAMP SAUCER EAMES ERA

VINTAGE MID CENTURY 1950's GOLD BRASS RETRACTABLE CEILING LAMP SAUCER EAMES ERA Thank you for watching Visit us at http://SMILEatTheDEALS.com Add us on Facebook ...

Twin Goose Neck Retro Lamp 1950's
Twin Goose Neck Retro Lamp 1950's

1950s Siamese cat lamp
1950s Siamese cat lamp

Just wanted to show my 1950s Siamese cat lamp once again since I was sorta bored and I know you people's don't hardly see anything like this very often. Whenever I look at it, it really brings...

Vintage 1950's Maddux California Ceramic White Swan Lamp Light Planter
Vintage 1950's Maddux California Ceramic White Swan Lamp Light Planter

Vintage Maddux California ceramic white Swan planter lamp light fully working in damage free condition made from a fine ceramic mix wonderful in colour of a rich creamy white with fine detail...

Siamese cat lamp (1950s)
Siamese cat lamp (1950s)

I got this for Christmas from my mom and she said she got it from a house in Kentucky (ordered it from online I believe). I do believe she said it was produc...

Panther Table Lamp 1950's era
Panther Table Lamp 1950's era

Excellent working table lamp.

Japanese 1950s vintage Merry Lamp
Japanese 1950s vintage Merry Lamp

via YouTube Capture.

Antique 1950's Oil Lamp Signed.avi
Antique 1950's Oil Lamp Signed.avi

Item:Antique 1950's Oil Lamp Signed Company:Houseofgoldentreasuresinc Web:http://myworld.ebay.com/houseofgoldentreasuresinc Selling:antiques&fine Art.

Most Popular Holiday Unique Gift Choice 2011 Vintage 1950's MOTION LAMPS Prices soar!
Most Popular Holiday Unique Gift Choice 2011 Vintage 1950's MOTION LAMPS Prices soar!

1951 Green Giant spinning christmas tree motion lamp. EXTREMELY RARE !!! Original Box too... Spins from heat of light bulb... Really incredible collectors dream .. Stands 24" tall...

1950's PAIR of GLASS GONE WITH THE WIND HURRICANE LAMPS w/ GOLD LEAF FLOWER DESIGN & GLASS CHIMNEY
1950's PAIR of GLASS GONE WITH THE WIND HURRICANE LAMPS w/ GOLD LEAF FLOWER DESIGN & GLASS CHIMNEY

VINTAGE 50's PAIR of GLASS GONE WITH THE WIND HURRICANE LAMPS w/ GOLD LEAF FLOWER DESIGN & GLASS CHIMNEY Thank you for watching Visit us at http://

How to Re-wire a vintage 3-light Lamp
How to Re-wire a vintage 3-light Lamp

Mid-Century MacGyver's inaugural episode! In this video, I walk you through all the steps necessary to re-wire and refinish a 1950s 3-light floor lamp. I know it's not the best, as this was...

Chandelier - Spanish Brass Chandelier 1950's Era
Chandelier - Spanish Brass Chandelier 1950's Era

http://TheLightingPalace.com 916-817-9625 Chandelier - Spanish Brass Chandelier 1950's Era 10 Bulbs 60w max We specialize in repair and restoration of antique and vintage lamps, chandeliers,...

Chandelier - 2 Tier Solid Brass Crystal Chandelier 1950's Era
Chandelier - 2 Tier Solid Brass Crystal Chandelier 1950's Era

http://TheLightingPalace.com 916-817-9625 Chandelier - 2 Tier Solid Brass Crystal Chandelier 1950's Era We specialize in repair and restoration of antique and vintage lamps, chandeliers, crystal...

Antique Light - Flush Mount Italian Light 1950's Era
Antique Light - Flush Mount Italian Light 1950's Era

http://TheLightingPalace.com 916-817-9625 Antique Light - Flush Mount Italian Light 1950's Era We specialize in repair and restoration of antique and vintage lamps, chandeliers, crystal chandelier...

Vintage 1950s Spanish Colonial-Style Wrought Iron Lamps
Vintage 1950s Spanish Colonial-Style Wrought Iron Lamps

Here's video of one of the lamps mentioned.

Chandelier - Small Bead Brass Chandelier 1950's Era
Chandelier - Small Bead Brass Chandelier 1950's Era

http://TheLightingPalace.com 916-817-9625 Chandelier - Small bead Brass Chandelier 1950's Era 12 light 40w bulb max We specialize in repair and restoration of antique and vintage lamps, ...

1950's coal mining preparing to go underground.  Archive film 92653
1950's coal mining preparing to go underground. Archive film 92653

The coal miner in the 1950's. Work clothes. Lamp house. Lamp checks and checks for no tobacco or matches.

Antique Light - Baby Brass Flush Mount Italian light 1950's Era
Antique Light - Baby Brass Flush Mount Italian light 1950's Era

http://TheLightingPalace.com 916-817-9625 Antique Light - Baby Brass Flush Mount Italian light 1950's Era 3 bulbs 60w max We specialize in repair and restoration of antique and vintage lamps,...

Electroluminescent Lamps - How it Works & Inventors
Electroluminescent Lamps - How it Works & Inventors

EL displays and lamps, they use phosphors directly excited by current to create light. The EL lamp and display were invented in the 1950s and have since evolved into advanced color monitors...

Antique American Mid-century modern (1950s) limed oak styliz
Antique American Mid-century modern (1950s) limed oak styliz

http://newel.com/PreviewImage.aspx?ItemID=15433 - Newel.com: Antique American Mid-century modern (1950s) limed oak stylized carved nude female torso mounted as a lamp on an ebonized ...

VINTAGE 1950's BELL & HOWELL 606H CINI FILM PROJECTOR TABLE LIGHT DESK LAMP
VINTAGE 1950's BELL & HOWELL 606H CINI FILM PROJECTOR TABLE LIGHT DESK LAMP

VINTAGE 1950's BELL & HOWELL 606H CINI FILM PROJECTOR TABLE LIGHT DESK LAMP isjustaclickaway eBay UK.

Chandelier - Spanish Baby Brass Chandelier 1950's Era
Chandelier - Spanish Baby Brass Chandelier 1950's Era

http://TheLightingPalace.com 916-817-9625 Chandelier - Spanish Baby Brass Chandelier 1950's Era We specialize in repair and restoration of antique and vintage lamps, chandeliers, crystal chandelie ...

New 1950s era striplights installed in my shop
New 1950s era striplights installed in my shop

Probably not keeping them in these locations, open to suggestions. Lustra 2 lamp, "Good Manufacturing" single lamp. I buy, sell, and trade vintage ceiling fans. Check out the forum at vintageceil...

1950s Factory Operation - This Is Automation - Automated Manufacturing - CharlieDeanArchives
1950s Factory Operation - This Is Automation - Automated Manufacturing - CharlieDeanArchives

This Is Automation! Factory scenes show: Electric irons Automotive engine blocks and pistons Electric motors Fluorescent lamp starters, including testing Automotive (ignition coil) condensers,...

Chandelier - Spanish Solid Brass Baby Chandelier 1950's
Chandelier - Spanish Solid Brass Baby Chandelier 1950's

http://thelightingpalace.com 916-817-9625 Chandelier - Spanish Solid Brass Baby Chandelier 1950's 4 60w candelabra bulbs We specialize in repair and restorat...

1950s-1970s Trix Commercials (Trix Rabbit)
1950s-1970s Trix Commercials (Trix Rabbit)

1. Photos of original 1950s Trix boxes and advertisement (pre-rabbit) 2. 1950s Trix with kids and song #1 3. 1950s Trix with kids and song #2 4. 1959 Trix with the debut of the poor...

Mother Deer and Fawn Retro Table Lamp
Mother Deer and Fawn Retro Table Lamp

1950's table lamp working fine.

Antique Pair of Italian 1950s fluted amethyst glass table
Antique Pair of Italian 1950s fluted amethyst glass table

http://newel.com/previewimage.aspx?itemid=14939 - Newel.com: Antique Pair of Italian 1950s fluted amethyst glass table lamps with a gold dusted glass cen...

Antique Pair of Italian 1950s (att: SEGUSO) Venetian Murano
Antique Pair of Italian 1950s (att: SEGUSO) Venetian Murano

http://newel.com/PreviewImage.aspx?ItemID=13813 - Newel.com: Antique Pair of Italian 1950s (att: SEGUSO) Venetian Murano green iridescent glass shaped design glass table lamps with ...

Antique Pair of Italian 1950s Murano "A BOLLE" white glass
Antique Pair of Italian 1950s Murano "A BOLLE" white glass

http://newel.com/PreviewImage.aspx?ItemID=14932 - Newel.com: Antique Pair of Italian 1950s Murano "A BOLLE" white glass table lamps with shaped form and fluted internal bubble design ...

DC-3 AIRPLANE ASHTRAY CHROME 1950'S STYLE
DC-3 AIRPLANE ASHTRAY CHROME 1950'S STYLE

THIS IS A DC-3 ASHTRAY / LAMP THAT WAS MOST LOBBY`S OF THE HOTELS BACK IN THE 50`S .. THESE WERE MOSTLY MADE IN TORONTO CANADA .. THERE IS A SWITCH THAT COMES ...

South Wales Valleys, 1950's.  Archive film 92686
South Wales Valleys, 1950's. Archive film 92686

A day in the life of a valley town in Wales in the 1950's. The terraces of miner's cottages crammed into and along the valleys. Camera tracks along rows of back-to-back valleys streets. A...

Preheat shoplight and 1950s striplight installed in my shop
Preheat shoplight and 1950s striplight installed in my shop

I swapped the Lustra 2 lamp striplight for the third 1940s "General Day-Lite" shoplight. Not sure what to do about the "Good Manufacturing" striplight. Looking for suggestions. I buy, sell,...

Threading the 16mm Projector circa 1950s Iowa State University
Threading the 16mm Projector circa 1950s Iowa State University

more at http://photo-video.quickfound.net/ Demonstrates threading of an RCA 16mm film projector. "How-to film produced to ensure quality shows and prevent destruction of films." Public domain...

Antique Pair of Italian 1950s Venetian Murano fluted pink
Antique Pair of Italian 1950s Venetian Murano fluted pink

http://newel.com/previewimage.aspx?itemid=13911 - Newel.com: Antique Pair of Italian 1950s Venetian Murano fluted pink glass lamps with hour glass shape ...

Light Bulbs - Animation about light bulbs and how they work. 1950's
Light Bulbs - Animation about light bulbs and how they work. 1950's

Light Of Your Life - Nancy is reading fairy tales under dim light and gets a higher power bulb from the maid for the lamp. An animated man pops out of the light bulb and tells her all about...

Related Producers: newelantiques4lightingpalacesmileatthedealsmtspiffygwoldstuffhuntleyfilmarchiveskGrlNoCw3l4QnJsFhsGgXAfairlane500skylinergroushedisontechcentercharliedeanarchiveswebdev17bel99tvmr455wildhorsesgenius7277midcenturymacgyverMvoBFyqzgsgVH3sbhvzDWwzfVMNx_bfSJU0k6kcJxxWQsbatncplpcnsfojFcqmmfkGaKVNStgaudubon5425lamptoursjayleabeangrandpastradingcoio1DG1OY6Ch79BBRmCH7Ygbargainhuntvidsip7NMA9G8Q91RATUdrEG1Qnakedmeninmybedlisanagain

Find the Videos, Producers, & Vloggers You Want Faster