vidgrids.com : Online Video Search & Discovery Engine :

Kepadatan Lele Videos

Kolam Lele Padat Tebar
Kolam Lele Padat Tebar

Kepadatan pembesaran lele yang normal adalah antara 150-250 ekor/m3. Kami mencoba dengan kepadatan 600-1000 ekor/m3. Lebih hemat lahan dan menguntungkan.

budidaya lele.flv
budidaya lele.flv

KEPADATAN LELE 600/M2 SUNGGUH LUAR BIASA.... MAU COBA ? LIHAT DULU TUTORIALNYA.....

system biofloc pembesaran lele
system biofloc pembesaran lele

pembesaran lele dengan kepadatan 1000/m menggunakan system biofloc minim ganti air boleh di katakan tidak pernah dan sangat menekan fcr yang telah didapat 0,...

lele super intensif sistem boster.flv
lele super intensif sistem boster.flv

UPBAT Dlangu - Mojokerto Menerapkan pola budidaya lele super intensif sistem boster dengan kepadatan mencapai 1000 ekor / m2, Bagaimana pola budidaya lele su...

Lele RAS System/lele sistem resirkulasi.MP4
Lele RAS System/lele sistem resirkulasi.MP4

Budidaya lele dengan sistem resirkulasi, kolam terpal rangka besi, 2x2 m, kepadatan 2000 ekor, keistemewaan kolam tidak berbau, minim tukar air. Alat yang di...

budidaya lele intensif bioflokTulungagung
budidaya lele intensif bioflokTulungagung

budidaya lele kepadatan diatas 500ekor/permeter persegi dalam kolam bulat (silinder) diameter 1,5 meter tinggi air 1 meter dengan perlakuaan tertentu budiday...

Penaburan Benih Lele tehnik budidaya lele boster
Penaburan Benih Lele tehnik budidaya lele boster

waktu pertama kali penaburan benih lele di kolam terpal padat tebar tinggi dengan jumlah kepadatan 7000 ekor ukuran 3 x 3 meter.

Budidaya Lele Phyton. Kota Stabat - Sumatera Utara.
Budidaya Lele Phyton. Kota Stabat - Sumatera Utara.

Lele Phyton tidak hanya gampang dipelihara. Modal membudidayakan ikan lele ini juga tidak besar. Budi Daya Ikan Lele Phyton seperti halnya budi daya ikan lel...

suskes budidaya lele dengan padat tebar 1000\m
suskes budidaya lele dengan padat tebar 1000\m

pembesaran lele dengan kepadatan 1000/m menggunakan system mubi minim ganti air dan tanpa Aerasi \ aerator untuk fcr terendah 0.6 sampai saat ini website ..

Lele kolam bis beton
Lele kolam bis beton

Pelihara Lele dengan Kolam bis beton. Kepadatan 1200 ekor, umur 22 hari. Ukuran awal tebar 3-4 cm.

Cara Pembudidayaan dan Bisnis Ikan Lele
Cara Pembudidayaan dan Bisnis Ikan Lele

Budidaya ikan lele sangat diminati para peternak karena pasarnya yang terus berkembang. Pemerintah juga gencar memberikan dukungan melalui riset benih lele u...

video ikan lele randi farm.avi
video ikan lele randi farm.avi

Penampakan ikan lele yang segar, dengan kulit cerah, perut gemuk , kencang namun lincah. Serta suasana kolam yang tidak ada sama sekali ikan yang stress deng...

Lele Kolam Terpal, padat tebar 5000 ekor. Umur 30 hari
Lele Kolam Terpal, padat tebar 5000 ekor. Umur 30 hari

Ini adalah kolam terpal dengan ukuran 4x3 dengan kepadatan 5000 ekor. Umur tebar 1 bulan. Kami menggunakan Nitrobacter sebagai probitik untuk mengatasi bau k...

Ikan lele jumbo dgn jumlah 1600 di kolam 2
Ikan lele jumbo dgn jumlah 1600 di kolam 2

This video was uploaded from an Android phone.

cara ternak lele
cara ternak lele

Video cara ternak lele terbaru. mau cara budidaya lele khusus untuk pemula? silahkan kunjungi website : http://caraternaklelepemula.com cara ternak lele cara...

Budidaya Bibit Ikan Lele Dumbo
Budidaya Bibit Ikan Lele Dumbo

Budidaya Bibit Ikan Lele Dumbo Hal yang sangat penting untuk diketahui bila kita ingin membudidayakan ikan lele dumbo untuk tujuan pembibitan adalah saat pem...

kolam lele tanpa bau tanpa ganti air tanpa filter tanpa pompa dan ikan mati saja tidak bau
kolam lele tanpa bau tanpa ganti air tanpa filter tanpa pompa dan ikan mati saja tidak bau

simak Doktor Perikanan Kelautan Unhas Makassar = https://dl.dropboxusercontent.com/u/54438819/testimoni_pertanian/I_048_indro_cahyana_unhas_oxigen.mp3 Simak ...

[Heboh] Misteri Ribuan Lele Sebelum Longsor Banjarnegara
[Heboh] Misteri Ribuan Lele Sebelum Longsor Banjarnegara

Sepekan sudah bencana longsor maut di Dusun Jemblung Desa Sampang, Banjarnegara, Jawa Tengah, terjadi. Dusun kecil di lereng Dieng ini pun mendadak populer, ...

7000 ekor ikan lele umur 2 bulan setengah
7000 ekor ikan lele umur 2 bulan setengah

budidaya lele padat tebar 7000 ekor tanpa ganti air PRODUKSI LELE DENGAN SISTEM TEBAR PADAT TINGGI Menyiapkan air kolam Tidak sembarang air bisa digunakan bu...

FISH BOSTER CENTRE : LELE PADAT TEBAR SISTEM BOSTER
FISH BOSTER CENTRE : LELE PADAT TEBAR SISTEM BOSTER

Untuk memenuhi asumsi kebutuhan nutrisi yang dibutuhkan ikan lele, dan meningkatkan digestibility pakan serta untuk memacu sistem metabolisme pencernaan juga...

lele padat tebar @lelekitacom
lele padat tebar @lelekitacom

Meningkatkan produksi lele di lahan terbatas dengan sistem padat tebar, 500-1000 ekor/m2. Dengan kolam ukuran 3x3m berisi 6000-10000 ekor ikan lele. Lahan se...

Kolam bis beton padat tebar 1200
Kolam bis beton padat tebar 1200

Bis beton ukuran/diameter 80cm dengan kepadatan 1200 ekor. Umur lele 1 minggu setelah tebar.

Bencana Longsor dan Ribuan lele di Banjarnegara
Bencana Longsor dan Ribuan lele di Banjarnegara

Mendekati akhir tahun 2014, publik Indonesia kembali dirundung duka karena bencana tanah longsor yang terjadi di dusun Jemblung, desa Sampang, kecamatan Kara...

Perbedan Jantan vs Betina Lele Sangkuringa Abah Nasrudin
Perbedan Jantan vs Betina Lele Sangkuringa Abah Nasrudin

perbedaan lele sangkuriang jantan dan betina yang bisa dilihat langsung.. berguna untuk pembibitan para petani lele secara kasat mata dapat dilihat dari alat...

Ternak Lele Bibit dari  Tayu Pati, Jateng
Ternak Lele Bibit dari Tayu Pati, Jateng

Luas kolam lele 20x20, kolam tanah, kedalam se-dada manusia. Jumlah 45-50rb ekor.

Lele Probiotik Padat Tebar Tinggi Bioflok (Probiotic & Biofloc)
Lele Probiotik Padat Tebar Tinggi Bioflok (Probiotic & Biofloc)

Lele Probiotik Padat Tebar Tinggi Bioflok (Technology Probiotic & Biofloc) Farm Budidaya Lele BB1819, Ciseeng, Sawangan, Bogor. agribisnis-indonesia.com ...

Pelatihan Bisnis Budidaya Kolam lele Bioflok Probiotik
Pelatihan Bisnis Budidaya Kolam lele Bioflok Probiotik

Pelatihan Bisnis Budidaya Kolam lele Sangkuriang Bioflok Probiotik Cheria Farm Bintaro Jakarta Selatan More Info : http://cheriafarm.blogspot.com/ Assalamual...

Budidaya Lele - Tips untuk mengurangi Konsumsi Pakan
Budidaya Lele - Tips untuk mengurangi Konsumsi Pakan

PEMBERIAN SUPLEMEN untuk Kurangi Konsumsi Pakan ikan lele Sama seperti pada usaha pembenihan, usaha pembesaran lele juga memerlukan suplemen untuk meningkatk...

Lele system BOSTER yang sangat menguntungkan
Lele system BOSTER yang sangat menguntungkan

Bismillah..... Veteran farm beralamatkan di kota blitar jawatimur , menerapkan system boster padat tebar dengan kolam uk. 3 m x 10 m menampung 60.000 ekor ik...

Wisata Ke Kampung Lele, Boyolali
Wisata Ke Kampung Lele, Boyolali

Kampung Lele terletak di Kecamatan Sawit, kabupaten Boyolali. Disebut kampung lele dikarenakan daerah tersebut banyak penduduk yang memelihara lele sebagaiam...

Kesaksian Budidaya Lele.3gp
Kesaksian Budidaya Lele.3gp

Kesaksian pengguna produk NAS untuk budidaya lele. Luas kolam 800m2 dengan jumlah ikan lele 35.000 ekor dengan ukuran 3-5 cm. Produk yang digunakan TON, POC ...

Ide Bisnis 2015 Budidaya Ikan Lele Dumbo
Ide Bisnis 2015 Budidaya Ikan Lele Dumbo

http://goo.gl/GtN8sB Lele Dumbo Berkah yang Membawa Keuntungan Prospek Usaha Beternak Ikan Lele Bertahun yang lalu masih banyak orang yang enggan beternak le...

perkembangan lele bioflok mas kesit tw dengan padat tebar 2000/m3
perkembangan lele bioflok mas kesit tw dengan padat tebar 2000/m3

umur 1 bulan dari ukuran 4cm, perkembangan normal, perlakuan pake protein rekombinan dan suplemen fish probio serta kontrol.

panen ikan lele phyton gede sangat
panen ikan lele phyton gede sangat

Lele piton tidak hanya gampang dipelihara. Modal membudidayakan ikan berkumis dengan badan bongsor terebut juga tak besar-besar amat, kok. "Tidak banyak dana...

budidaya lele bioflok mas kesit tw dengan padat tebar 2000/m3
budidaya lele bioflok mas kesit tw dengan padat tebar 2000/m3

awal tebar ukuran 4cm, perlakuan pake protein rekombinan dan suplemen fish probio serta kontrol.

Persiapan Penetasan Telur Ikan Lele
Persiapan Penetasan Telur Ikan Lele

Proses persiapan ijuk di Bak Penetasan di Pusat Pelatihan dan Pembenihan Ikan Lele Al Kautsar Batam.

lele super intensif sistem boster, kolam bis beton Godean 500.mp4
lele super intensif sistem boster, kolam bis beton Godean 500.mp4

Memanfaatkan lahan sempit utk budidaya lele 'sistem boster' menggunakan media kolam 'bis beton' dg kontruksi kolam sistem boster ( central drain ) terbukti m...

Pembuatan Pelet Ikan ( Hendrik Fish Farm Madiun )
Pembuatan Pelet Ikan ( Hendrik Fish Farm Madiun )

Kebutuhan pakan ikan atau pelet ikan dalam usaha budidaya ikan merupakan aspek utama yang harus diperhatikan. Anda harus pandai mengelola jumlah pakan dan je...

BUDIDAYA LELE PADAT TEBAR SISTEM BOSTER
BUDIDAYA LELE PADAT TEBAR SISTEM BOSTER

BUDIDAYA LELE SUPER INTENSIF SISTEM BOSTER, lebih Efisien & Menguntungkan...... Dengan capaian FCR tersebut tentu akan meningkatkan profit, karena komponen b...

Video Usaha Produksi Abon Lele
Video Usaha Produksi Abon Lele

Silahkan kunjungi juga http://pelakuukm.blogspot.com untuk artikel seputar dunia usaha lainnya.

SUKSES BERSAMA P2MKP RAJA LELE BANYUWANGI
SUKSES BERSAMA P2MKP RAJA LELE BANYUWANGI

membuka pelatihan budidaya lele super intensif dan pengolahan ikan lele berupa nuget, sosis, abon lele, krupuk lele, tahu lele, martabak lele dan singkan (kr...

Panen Lele Kolam NITROBACTER Mas Budi di Sokaraja Banyumas
Panen Lele Kolam NITROBACTER Mas Budi di Sokaraja Banyumas

Kolam tebar padat mas Budi di Jalan Sidodadi No.202, Sokaraja, Kab. Banyumas (Jawa Tengah) yang menggunakan "Nitrobacter", hari Minggu 14 April 2013 mulai pa...

Lele Terpal Padat Tebar
Lele Terpal Padat Tebar

Tujuan budidaya lele padat tebar dengan sistem RWS (air masih hijau) Kolam terpal 2x4 bibit masuk ukuran 9, dipelihara sebelumnya dari ukuran 5-7 selama 3 mi...

jual ikan lele sangkuriang murah
jual ikan lele sangkuriang murah

jika anda membutuhkan ikan lele jenis sangkuriang dalam jumlah banyak Hubungi 087718973032 kami siap mengantarkan langsung ke tempat anda.. untuk info lebih ...

Beli Ikan Lele
Beli Ikan Lele

Bursa Jual-Beli: http://agrosukses.com/ Beli ikan lele hidup ukuran konsumsi dalam jumlah berapapun. INFO LENGKAP: http://agrosukses.com INFO LAINNYA...

Pembukaan Pelatihan Budidaya Ikan Lele Sistem Bioflock
Pembukaan Pelatihan Budidaya Ikan Lele Sistem Bioflock

Video ini merupakan liputan pelaksanaan kegiatan Pembukaan Pelatihan Budidaya Ikan Lele Sistem Bioflock di Pondok Pesantren Nurul Huda Kecamatan Cijeruk Kabu...

Ternak lele padat tebar 15000 ekor kolam 3x5
Ternak lele padat tebar 15000 ekor kolam 3x5

BUDIDAYA LELE RAJA LELE BANYUWANGI SEG3
BUDIDAYA LELE RAJA LELE BANYUWANGI SEG3

Related Producers: indoscobosterGx3NPNuyZ7x8Y4NivIOiGQkekerangabaidi1710hermanavailablecyberndaalkautsarbatamn9aVObr5PAlLFjj5KRu8LQ-BZEF9jhJCtPjJzNfPiTBQ_u1fWpbWZuyeGzfqnGBVrQceoOdQqPsJpe1EFj856PPQpupuknasakonyostv3m-1F3TFlI-hf7mMtjSVMwrapikanHqNXgpRerAldyCEwHdOa-AsbotivifulSsGLPof9ynthomsOOQohMAkvw1jJeEbfYV9izDY2KRxQachmadjauhari1966ivankurniawan78M8EJbyz9mDK24BCDWgKi-AnrachmanbizaIfm1UnYyuPb3HkdEeMOvgthefarmrandiarsyadprimitifthedediajauZPxClYlDyEUJmFI67fesgagrokomplekhA5yIuSyb2JVFigw-ffsfQhajitiginVZ9LuO4EWTasAKSdoAMWygdhermawantocheriatnarumahfresh9I2D0dA4fI_Cvgza8JQo5gtmskaca1234lUhi0VdY36-eoUEdeu652wtoetri

Find the Videos, Producers, & Vloggers You Want Faster