vidgrids.com : Online Video Search & Discovery Engine :

Kolam Lele Videos

Kolam Lele 10.000 Ekor ( Hendrik Fish Farm )
Kolam Lele 10.000 Ekor ( Hendrik Fish Farm )

Informasi Silahkan Kunjungi Kami Facebook : https://facebook.com/hendrik.wahyuistanto Website : http://hendrikfishfarm.blogspot.com/ Email : hendrick_wahyu@yahoo.com Alamat ...

Kolam Lele Padat Tebar
Kolam Lele Padat Tebar

Kepadatan pembesaran lele yang normal adalah antara 150-250 ekor/m3. Kami mencoba dengan kepadatan 600-1000 ekor/m3. Lebih hemat lahan dan menguntungkan.

ternak lele kolam bundar amazing!!! CATFISH BREEDING CIRCULAR POOLS METHOD
ternak lele kolam bundar amazing!!! CATFISH BREEDING CIRCULAR POOLS METHOD

ternak lele kolam bundar amazing!!! CATFISH BREEDING CIRCULAR POOLS METHOD Kelebihan kolam Bundar/Bulat Lebih bagus untuk penerapan tebar padat tinggi, karena apabila ditambah ...

TAHAP 1. cara membuat kolam lele sistem organik dengan terpal, lebih menguntungkan!!
TAHAP 1. cara membuat kolam lele sistem organik dengan terpal, lebih menguntungkan!!

Sistem pembuatan kolam lele dengan organik, pupuk kandang lebih irit pakan di awal perawatan lele.

Persiapan Kolam Lele Sederhana
Persiapan Kolam Lele Sederhana

Kolam Lele Cheria Farm Bintaro
Kolam Lele Cheria Farm Bintaro

Kolam Budidaya Lele Cheria Farm Bintaro Kunjungi http://cheriafarm.blogspot.com Beberapa tahun belakangan ini kolam terpal bundar mulai populer bagi kalangan peternak ikan terutama di...

Beternak Ikan Lele Kolam semen
Beternak Ikan Lele Kolam semen

Budidaya Lele Menggunakan Kolam Terpal
Budidaya Lele Menggunakan Kolam Terpal

Budidaya Lele Menggunakan Kolam Terpal.

kolam lele tanpa bau tanpa ganti air tanpa filter tanpa pompa dan ikan mati saja tidak bau
kolam lele tanpa bau tanpa ganti air tanpa filter tanpa pompa dan ikan mati saja tidak bau

simak Doktor Perikanan Kelautan Unhas Makassar = https://dl.dropboxusercontent.com/u/54438819/testimoni_pertanian/I_048_indro_cahyana_unhas_oxigen.mp3 Simak Litbang Teknologi Prop ...

Cara Pembuatan Kolam Ikan Lele dari Terpal. ^_^ Part-1.
Cara Pembuatan Kolam Ikan Lele dari Terpal. ^_^ Part-1.

Memelihara ikan lele dengan menggunakan kolam buatan dari terpal sangat efektif dan efisien, biaya lebih murah dan bisa di lahan terbatas, mudah perawatan, ikan tampak bersih dan berkualitas....

CARA BUDIDAYA IKAN LELE DUMBO DI KOLAM SEMEN
CARA BUDIDAYA IKAN LELE DUMBO DI KOLAM SEMEN

Salah satu contoh budidaya ikan lele pada tahap peneluran. Sepertinya untuk kolam terpal sama saja.

Pelatihan Budidaya Lele Sangkuriang Kolam Terpal di Jakarta
Pelatihan Budidaya Lele Sangkuriang Kolam Terpal di Jakarta

Pelatihan Budidaya Lele Sangkuriang Kolam Terpal di Jakarta Info http://cheriafarm.com.

Cara Sederhana membuat Kolam Ikan Lele dari Baliho
Cara Sederhana membuat Kolam Ikan Lele dari Baliho

Pembuat Kolam: Dablang ARS Vexbur FB: https://facebook.com/dablang.vexbur ------------------------------------------ Info untuk: - budidaya lele - budidaya ikan lele - ternak lele - ternak...

Cara Budidaya Lele Sistem Kolam Terpal
Cara Budidaya Lele Sistem Kolam Terpal

Cara Budidaya Ikan Lele di Kolam Terpal - Budidaya lele adalah salah satu bisnis yang cukup menjanjikan. Betapa tidak permintaan pasar akan ketersediaan ikan lele semakin besar dari tahun ke...

Jambi Mancing Mania Moris Lele Babon Kolam R & R
Jambi Mancing Mania Moris Lele Babon Kolam R & R

Jambi Mancing Mania Moris Lele Babon Kolam R & R Paal 6 Kotabaru Jambi.

Lele sangkuriang di kolam terpal.mp4
Lele sangkuriang di kolam terpal.mp4

"Kolam terpal dengan padat tebar & sosis sebagai pakan penambah berat" Di jual sosis kadaluarsa,kondisi sosis masih utuh tidak remuk. Stock ada 1 ton harga kg 4500 silahkan ambil sendiri....

Budidaya lele di kolam terpal *mudah dan terbaik 2014*
Budidaya lele di kolam terpal *mudah dan terbaik 2014*

budidaya lele pakan ikan lele cara budidaya lele download belajar sukses budidaya lele sangkuriang budidaya lele di kolam terpal budidaya gurami budidaya ikan lele budidaya lele organik budidaya.

Pembuatan Kolam Lele
Pembuatan Kolam Lele

Uk. kolam 4 x 2 m perlatan perangnya ada pacul, big garpu, dll Taruna Tani Muda Kreatif Mandiri.

Lele Kolam Terpal padat tebar 5000
Lele Kolam Terpal padat tebar 5000

Kolam ukuran 5x3 meter, padat tebar 5000 ekor. Umur lele 35 hari. Probiotik yang digunakan: Nitrobacter produksi sendiri. Kolam tidak bau, ikan sehat-sehat dan selera makan kuat. Dalam video...

Pelatihan Bisnis Budidaya Kolam lele Bioflok Probiotik
Pelatihan Bisnis Budidaya Kolam lele Bioflok Probiotik

Pelatihan Bisnis Budidaya Kolam lele Sangkuriang Bioflok Probiotik Cheria Farm Bintaro Jakarta Selatan More Info : http://cheriafarm.blogspot.com/ Assalamualaikum wr wb, Alhamdulillah kami...

MANCING MANIA DI KOLAM LELE
MANCING MANIA DI KOLAM LELE

Mancing Lele Di Kolam...

BioSugih Ikan Lele Di Kolam Terpal
BioSugih Ikan Lele Di Kolam Terpal

Aplikasi BioSugih Tambak Untuk Meningkatkan Protein Dan Membesarkan Lele Di Kolam Terpal BioSugih Tambak yang sekarang sedang di giatkan adalah membesarkan ikan lele, biasanya ...

Pembuatan kolam lele media plastik pola hcs I PETERNAK MODERN
Pembuatan kolam lele media plastik pola hcs I PETERNAK MODERN

Cara sederhana buat kolam budidaya lele pola hcs I PETERNAK MODERN.

panenan lele "Nitrobacter TJ" kolam tanpa bau tanpa aerasi udara dan tanpa harus kuras air
panenan lele "Nitrobacter TJ" kolam tanpa bau tanpa aerasi udara dan tanpa harus kuras air

Hati-hati situs2 di Internet beredar jual Nitrobacter Barang Palsu, Repacking dan Kadaluwarsa !!, hanya Reseller NITROBACTER TJ yang telah mengikat MOU dan menjadi agen resmi adalah ...

Budidaya Lele Phyton. Kota Stabat - Sumatera Utara.
Budidaya Lele Phyton. Kota Stabat - Sumatera Utara.

Lele Phyton tidak hanya gampang dipelihara. Modal membudidayakan ikan lele ini juga tidak besar. Budi Daya Ikan Lele Phyton seperti halnya budi daya ikan lele dumbo bisa dilakukan pada kolam...

[Budidaya Ternak Lele] Kolam Lele Keluarga
[Budidaya Ternak Lele] Kolam Lele Keluarga

[Budidaya Ternak Lele] Kolam Lele Keluarga , pemanfaatan lahan kosong untuk bikin kolam yang bisa bermanfaat untuk lauk pauk serta membantu perekonomian keluarga. Tags : kolam lele modern,.

kolam lele
kolam lele

kolam lele bis beton ini adalah temuan baru bagi yang mempunyai lahan sempit dapat dimanfaatkan untuk budidaya lele dan pasitas bis beton berukuran diameter80cm dapat menampung lele ...

Keunggulan Nitrobacter Menghilangkan Bau Busuk Kolam Ikan Lele ~ Budidaya
Keunggulan Nitrobacter Menghilangkan Bau Busuk Kolam Ikan Lele ~ Budidaya

Selamat datang di channel budidaya peternakan, channel ini berisi vidio-vidio tentang tata cara membudidayakan, baik hasil pertanian, hasil perkebunan, perikanan, dan hasil peternakan. semua...

Lele by Biofloc Kolam Bundar
Lele by Biofloc Kolam Bundar

Budidaya Lele padat tebar.

lele super intensif sistem boster, kolam bis beton Godean 500.mp4
lele super intensif sistem boster, kolam bis beton Godean 500.mp4

Memanfaatkan lahan sempit utk budidaya lele 'sistem boster' menggunakan media kolam 'bis beton' dg kontruksi kolam sistem boster ( central drain ) terbukti mampu memperoleh hasil yg maksimal...

Lele Dumbo kolam tanah Sugiharto, lokasi Mancak- Anyer
Lele Dumbo kolam tanah Sugiharto, lokasi Mancak- Anyer

Video tsb diambil di Mancak, kolam milik Sugiharto pada tanggal 17 Februari 2013, usia lele 2 bulan, luas per kolam 60 M2 dengan 13.000 ekor bibit.

Cara pembuatan kolam ikan lele dari terpal. ^_^ Part-2
Cara pembuatan kolam ikan lele dari terpal. ^_^ Part-2

TAHAP 2. cara budidaya kolam lele sistem organik pupuk kandang, hemat pakan
TAHAP 2. cara budidaya kolam lele sistem organik pupuk kandang, hemat pakan

Setelah larutan EM4 dan pupuk kandang sudah benar benar tercampur maka selanjutnya adalah dengan menutup bagian atas dari pupuk tadi secara rapat. Kemudian biarkan selama kurang lebih ...

Awal Pembuatan Kolam
Awal Pembuatan Kolam

Budidaya, Ternak, Bisnis KLIK SINI http://youtube.com/channel/UCWmDaQk6njt3D9likph23pA.

Kolam Ikan Pemancingan | lomba mancing ~ ikan lele terbesar
Kolam Ikan Pemancingan | lomba mancing ~ ikan lele terbesar

Kolam Ikan Pemancingan | lomba mancing ~ ikan lele terbesar mancing ikan baung mancing indonesia mancing ikan tongkol lomba mancing mancing di sawah mancing di rawa mancing ikan gurame ...

2000 ekor ikan lele kolam terpal
2000 ekor ikan lele kolam terpal

This video was uploaded from an Android phone.

Panen Lele di Kolam Terpal
Panen Lele di Kolam Terpal

Alhamdulillah selama kurang lebih 3 bulan menunggu akhirnya bisa dipanen juga gan lele sangkuriang ane B-)...., sori kalo editannya kurang memuaskan, intinya dari ane cman mau nunjukin ...

Kolam Lele Bulat 1
Kolam Lele Bulat 1

Contoh kolam industri Lele rumahan. kemudian akan ditaambahkan dalam teknologi adalah pemberian pakan dengan Nano Sistem, diama diharapkan setiap berat pakan yang diberikan sebagai ...

Ikan lele kolam semen (ganti air) umur 1 minggu
Ikan lele kolam semen (ganti air) umur 1 minggu

Kolam ikan lele salah satu anggota pokdakan mina mulya , lampung selatan, sukamulya, palas. pokdakanminamulya.blogspot.com herijaya.com.

Mancing IKAN LELE BESAR di Kolam | MANCING MANIA
Mancing IKAN LELE BESAR di Kolam | MANCING MANIA

Maunya mancing di sungai atau di laut tapi waktu tidak memungkinkan. Akhirnya, kolam di depan rumah jadi spot-nya. Umpan jitunya, cukup CACING, tidak seperti umpan galatama yang cara ...

Lele Kolam Terpal, padat tebar 5000 ekor. Umur 30 hari
Lele Kolam Terpal, padat tebar 5000 ekor. Umur 30 hari

Ini adalah kolam terpal dengan ukuran 4x3 dengan kepadatan 5000 ekor. Umur tebar 1 bulan. Kami menggunakan Nitrobacter sebagai probitik untuk mengatasi bau kolam. Kolam tidak berbau sama ...

Kolam lele ane : Pengelolaan Air, Ransum dan Sistem Jaring
Kolam lele ane : Pengelolaan Air, Ransum dan Sistem Jaring

Filter yang saya gunakan dimaksud untuk mengurangi kandungan amonia di dalam air kolam dengan harapan ikan akan betah dan sehat. Ikan melepaskan amonia (NH3 dan NH4) kedalam air ...

Mutiara Situmorang Istri Jenderal Malah Pamer Kolam Lele, Padahal Sudah Jadi Tersangka
Mutiara Situmorang Istri Jenderal Malah Pamer Kolam Lele, Padahal Sudah Jadi Tersangka

Mutiara Situmorang Istri Jenderal Malah Pamer Kolam Lele, Padahal Sudah Jadi Tersangka.

Cara Budidaya Ikan Lele Sangkuriang di Kolam Terpal *mudah dan terbaik 2014*
Cara Budidaya Ikan Lele Sangkuriang di Kolam Terpal *mudah dan terbaik 2014*

budidaya lele pakan ikan lele cara budidaya lele download belajar sukses budidaya lele sangkuriang budidaya lele di kolam terpal budidaya gurami budidaya ikan lele budidaya lele organik budidaya.

perawatan Kolam Lele
perawatan Kolam Lele

Lele Dumbo kolam tanah, milik Sugiharto, lokasi di Mancak Anyer
Lele Dumbo kolam tanah, milik Sugiharto, lokasi di Mancak Anyer

Kolam ini dirancang dengan cara sederhana...alias masih tradisional, saat ini baru jadi 4 kolam, sedang yang lain masih dalam persiapan dikerjakan, kolam in i dibangun diatas tanah kurang lebih...

kolam lele padat tebar (NWS)
kolam lele padat tebar (NWS)

pembesaran lele dengan system NWS (natural water system).minim ganti air,hemat pakan,fcr0,7-0,8.padat tebar 800-1000ekor/m3.

Budidaya lele di kolam terpal
Budidaya lele di kolam terpal

ini adalah kompilasi gambaran tentang budidaya lele di kolam terpal.

Related Producers: cheriatnaGx3NPNuyZ7x8Y4NivIOiGQminniehsutmskaca1234lmdpimdesignerawangyulibudidayalelesupersetyan4blXPynNNJz1iAwXRQpfDHwWmDaQk6njt3D9likph23pAsBLDzMprd2hTUArgavSqWAbudidayapeternakanarsyadprimitifindoscobosterEbuIzeORRZ7ZDu1l9HAN7wkabarbergunawSnRY0jpCzdZfvYSHeR8cwWshLkAPhXDlav5A-XaMJEAmrapadkukareqxx5zX427BtT1gpAQpg1gsilorawikanHhBqs9uzYJwFEQ2LywaK7gtehamzmarsogoth_XWInPAjzLoAbkJzYyB2_wbocahhilangmasjokowithejedoorgru8hlGUXehVeIIV4US54Abaidi1710taqiyaljaumalytoetriSOVYiI7pZTcfSGr7IM2c1QY5ZSWNH9HbG_mRVf8sUEhwriuUclIKvX0_HGWcfd2eJAn9aVObr5PAlLFjj5KRu8LQmumuabduladityawaskitathedediaja

Find the Videos, Producers, & Vloggers You Want Faster