vidgrids.com : Online Video Search & Discovery Engine :

Potterton Combi Repair Videos

Potterton Performa eco he  combi boiler hot water cant stop! Video 03
Potterton Performa eco he combi boiler hot water cant stop! Video 03

As Soon as the boiler power is on ( on stan by mode) burner was coming on without no external demand. no hot water taps are open, no central heating is calle...

New Potterton Gold Combi 24 HE - boiler installer colindale london hendon edgware Marble arch
New Potterton Gold Combi 24 HE - boiler installer colindale london hendon edgware Marble arch

This replacement boiler was installed after removing vey badly leaking Saunier Duval Thermaclassic boiler. THe landload did not want to get the old boiler be...

How to repressurise your boiler using a Flexible Hose Filling Loop
How to repressurise your boiler using a Flexible Hose Filling Loop

A step by step tutorial to guide you through the re-pressurisation of a Baxi, Potterton or main system or combination boiler. Be sure to watch right to the e...

Potterton Performa eco he  combi boiler hot water cant stop! Video 01
Potterton Performa eco he combi boiler hot water cant stop! Video 01

As Soon as the boiler power is on ( on stan by mode) burner comes on without no external demand. no hot water taps are open, no central heating is called..Wh...

Potterton Performa 24 - Diaphragm replacement .. Hot water failure .. Hole in diaphragm .. Repair
Potterton Performa 24 - Diaphragm replacement .. Hot water failure .. Hole in diaphragm .. Repair

via YouTube Capture.

Potterton Performa eco he  combi boiler hot water cant stop! Video 02
Potterton Performa eco he combi boiler hot water cant stop! Video 02

As Soon as the boiler power is on ( on stan by mode) burner comes on without no external demand. no hot water taps are open, no central heating is called..Wh...

What is a Baxi Potterton Gas Saver heat recovery system How Combi Boilers Gassaver Work
What is a Baxi Potterton Gas Saver heat recovery system How Combi Boilers Gassaver Work

The Multifit GasSaver flue gas heat recovery system is an innovative product. http://gasheatinginstallers.co.uk/special-offers/ that sits neatly between ...

Potterton Kingfisher bunner cutting off boiler repair Hampstead Village Highgate muswell hill
Potterton Kingfisher bunner cutting off boiler repair Hampstead Village Highgate muswell hill

Client was complaining that the heating bills are so high and it takes very long time to heat the house . No wonder with this very inefficient boiler and the...

Potterton Suprima Boiler DIY Repair CDrom
Potterton Suprima Boiler DIY Repair CDrom

Any Owners of the Potterton Suprima central heating boilers will at some point have a lockout problem (Red Flashing Light) that restricts the boiler working ...

Potterton Suprima 60 L boiler flashing red light - boiler repair Hampstead, Hendon, Highwood Hill,
Potterton Suprima 60 L boiler flashing red light - boiler repair Hampstead, Hendon, Highwood Hill,

This boiler was not giving and heating or hotwater. The boiler was flashing red light. When you try to Reset the boiler it still not working.The faulty part ...

Potterton Gold Combi Boiler
Potterton Gold Combi Boiler

Discounted Heating presents the Potterton Gold Combi Boiler and accessories available at discounted prices from discountedheating.co.uk.

post mortem of a Potterton profile Flue - repair boiler london
post mortem of a Potterton profile Flue - repair boiler london

The co ratio was too high when the boiler was working... Replaced the boiler with new.. now lets look at the flue... Flue intake is mixing with exaust gases....

Potterton Suprima 60 L boiler working after repair- heating service Edgware, Colindale, Hendon
Potterton Suprima 60 L boiler working after repair- heating service Edgware, Colindale, Hendon

This boiler was not working before. ( see video http://youtu.be/p3gHlYAEg6A) The boiler is now repaired by me. After the repair tas in this video the flame s...

Potterton profile boiler after repair
Potterton profile boiler after repair

This boiler was not working before.. it was not even sparking.. ( see link http://youtu.be/uBh49wh6Vh4) but when the cover was removed the boiler fan was com...

Potterton Powermax boiler repair - new pressure vessel, pressure switch and AAV.
Potterton Powermax boiler repair - new pressure vessel, pressure switch and AAV.

This Powermax boiler was not working properly due to 3 faults. All the faults were rectified and the bopiler was tested for safety. If you need a boiler serv...

Potterton profile 40 boiler after repair
Potterton profile 40 boiler after repair

Central heating problem Potterton  performa 24 eco Video 02.
Central heating problem Potterton performa 24 eco Video 02.

This Potterton combi has no problem with hot water but the central heating. .....Diverter valve is stuck on hot water.....can you see the spindle of the dive...

Potterton Netaheat 10 - 16 boiler working fine after repair.
Potterton Netaheat 10 - 16 boiler working fine after repair.

Boiler was faulty. This video was taken after the repair. http://youtu.be/IrI4CBBpRuA.

Potterton Netaheat electronic boiler working fine after repair
Potterton Netaheat electronic boiler working fine after repair

Potterton Performa 24 eco he boiler working fine after repair
Potterton Performa 24 eco he boiler working fine after repair

Potterton profile boiler is tripping electrics Boiler repair Holders Hill Mill Hill
Potterton profile boiler is tripping electrics Boiler repair Holders Hill Mill Hill

RCD has tripped, and the boiler is leaking water. How come a leaking water can trip the electrics to go off. Well its no No rocket science, water has free el...

Central heating problem Potterton performa 24 eco Video 01.
Central heating problem Potterton performa 24 eco Video 01.

This boiler was in Mount road, Hendon London NW9. I went to quote for the work. I have no call out charges for about 5 mile radius from where we are based. B...

Potterton Profile boiler - Gotta Go - potterton profile boiler repair london
Potterton Profile boiler - Gotta Go - potterton profile boiler repair london

Time for all the potterton Profiles to Go....Its Time! If you live in or around London within M25 and need a boiler service or other plumbing or electrical s...

PGS change a diverter valve on a Potterton combination boiler.
PGS change a diverter valve on a Potterton combination boiler.

Technical Director Richard Wallace changes a diverter valve on a Potterton Combination boiler. Richard begins by isolating the boiler with two valves, the fl...

Potterton netaheat boiler pilot & main burner working fine after repair
Potterton netaheat boiler pilot & main burner working fine after repair

Potterton Suprima 120 boiler after repair
Potterton Suprima 120 boiler after repair

Potterton Promax FSB HE boiler working  after repair
Potterton Promax FSB HE boiler working after repair

Main Combi 30 HE boiler working fine after repair
Main Combi 30 HE boiler working fine after repair

Main Combi 24 he flame failure - boiler repair Totteridge Woodside Park FInchley Acton
Main Combi 24 he flame failure - boiler repair Totteridge Woodside Park FInchley Acton

Common Problem with Main Combi 24 He so the manufacture went back to the drawing board and stocked up new part to replace there faulty part.. but the custome...

worcester combi boiler repair manchester
worcester combi boiler repair manchester

http://pro-boilers.co.uk/ worcester bosch combi boiler repair of a failed heat exchanger in south manchester if you need any combi repair or are considering ...

Potterton Performa 24 Leaking Diverter valve
Potterton Performa 24 Leaking Diverter valve

I was called to repair this Potterton Perfoma 24 boiler because it was not performing at all !. No wander the other Corgi engineer has taken the PCB ( printe...

Potterton Performa 24 Flame Failure.
Potterton Performa 24 Flame Failure.

Boiler was in West End Lane Pinner, Middlesex. The boiler was previously repaired by another engineer. I went to help him because boiler was still not workin...

Main Combi 24 HE   but Flame failure - Boiler repair engineer Willesden Neasden Hendon
Main Combi 24 HE but Flame failure - Boiler repair engineer Willesden Neasden Hendon

The Fan is coming on.. and the boiler stops there. This boiler was repaired by UniC UK Gas Safe Engineer. Now It is working normally. To see that , please Vi...

Vaillant Combi boiler working fine after repair -  - plumber N19 N7 plumbing repair service
Vaillant Combi boiler working fine after repair - - plumber N19 N7 plumbing repair service

After having the best summer for long time..people turned the central heating for the first time during last couple of weeks. I found three Vaillant boilers ...

Potterton Puma 80 E, good hot water but Central heating not working
Potterton Puma 80 E, good hot water but Central heating not working

Boiler was in Rushgrove Avenue, The Hyde London NW9. Hot water is working fine. But the central heating is not working properly. The system pressure was abou...

How to fill Potterton Performa System HE boiler - how to pressure
How to fill Potterton Performa System HE boiler - how to pressure

Fill it but don't spill it This boiler was repaired by Unic UK and it is working fine now. If you live in London within M25 and need a boiler service or othe...

Main Combi boiler after repair - North London plumber Boiler repair Engineer
Main Combi boiler after repair - North London plumber Boiler repair Engineer

This boiler was not working before ( see video : http://youtu.be/itsPk0k1elE ) UniC UK Plumber repaired the boiler. Now it is working fine. If you have Simil...

E168 - How to video guide for error code E168 on Baxi HE and HE A boilers
E168 - How to video guide for error code E168 on Baxi HE and HE A boilers

Brought to you by http://heateam.co.uk Service & Repair division for Baxi, Potterton, Main, Remeha and Heatrae Sadia. Hello and welcome to the heateam "h...

Combi boiler repair W1, W2, W3, W4, W5, W6, W7, W8, W9, W10, W11, W12, W13, W14, W15, W16
Combi boiler repair W1, W2, W3, W4, W5, W6, W7, W8, W9, W10, W11, W12, W13, W14, W15, W16

EMERGENCY CORGI PLUMBER 24 HOURS CHECK OUT WEBSITE : http://advancedheatinglondon.co.uk Tel 0207 166 7835 (working hours) 07765329957 (emergency / after ...

Potterton Performa 24 Eco he boiler hot water problem1
Potterton Performa 24 Eco he boiler hot water problem1

Repressurise potterton baxi boiler no filling loop
Repressurise potterton baxi boiler no filling loop

How to repressurise your boiler if you don't have a refilling loop/kit fitted. This I expect is now common on a lot of new build houses. It doesn't tell you ...

Potterton Performa 24 Eco HE no hot water.
Potterton Performa 24 Eco HE no hot water.

Central heating is working fine but hotwater is not coming. This combination boiler is installed to supply hotwater to the kitchen sink and heating to the ho...

How To Fix Your Heating Boiler DIY a Combi and Save Money
How To Fix Your Heating Boiler DIY a Combi and Save Money

(Consumers Revenge) Honest Reviews. Name and shame your combi boiler manufacturer in the comments section. (Boiler Repairs costing you a fortune?) After inst...

PGS Services carry out a service on a Potterton boiler in Chessington, Surrey.
PGS Services carry out a service on a Potterton boiler in Chessington, Surrey.

PLEASE NOTE: This is not a training video, work on any gas appliance should always be undertaken by a Gas Safe qualified engineer. Find out more: http://...

Potterton suprima boiler failure flashing red.
Potterton suprima boiler failure flashing red.

Client is telling that the boiler occationally work.. I asked why do you think it's working sometimes..He replied it could be the GOD. Well...the boiler was ...

Potterton Performa 24 Eco HE flame failure light flashes.
Potterton Performa 24 Eco HE flame failure light flashes.

The boiler was in the Buddist Temple at Booth Road, Colindale NW9. Ther was no flame before the flame failure lockout. So the ignition sequence seems to stop...

Potterton Netaheat 10 - 16 boiler making continuos attempt to light ! video 02.
Potterton Netaheat 10 - 16 boiler making continuos attempt to light ! video 02.

Okey soo it is sparking.. gosch.. sparking even from the circuit board.. so wots the problem..Faulty part was identified and the boiler was repaired the next...

Combi boiler repair shacklewell 02071667835
Combi boiler repair shacklewell 02071667835

FAMILY RUN EMERGENCY CORGI PLUMBER 24 HOURS CHECK OUT WEBSITE : advancedheatinglondon.co.uk Tel 0207 166 7835 (working hours) 07765329957 (emergency / af...

Related Producers: unicukexpertpropertycarebaxigrouphiphupwhoandrewkfletcherlisafwefswehypno3ablediscountedheatingbuddha3xu7Di9zGUpCxRA3JGlpGhtAsuprimaquickfixpowerflushinguk

Find the Videos, Producers, & Vloggers You Want Faster