: Online Video Search & Discovery Engine :

Roosevelt Speeches Videos

FDR DECLARES WAR (12/8/41) - Franklin Delano Roosevelt , WWII , Infamy Speech , 24400
FDR DECLARES WAR (12/8/41) - Franklin Delano Roosevelt , WWII , Infamy Speech , 24400

The Presidential Address to Congress on December 8, 1941. Known as the Infamy Speech, it was delivered at 12:30 p.m. that day to a Joint Session of Congress ...

I welcome their hatred F D Roosevelt
I welcome their hatred F D Roosevelt

On October 31, 1936, President Franklin D. Roosevelt gave a campaign speech before a crowd at Madison Square Garden. The words he spoke could be uttered in o...

Adolf Hitler Replies to President Roosevelt
Adolf Hitler Replies to President Roosevelt

As part of our huge series on Adolf Hitler, life in Germany under the Nazi Administration and World War II. We do not favour or share an opinion on Adolf Hit...

America Declares War on Japan - President Roosevelt Speech [Full Resolution]
America Declares War on Japan - President Roosevelt Speech [Full Resolution]

America Declares War on Japan - President Roosevelt Speech [Full Resolution]. On December 8, 1941, President Roosevelt declares war on Japan, the day after J...

FDR "The Fala Speech"
FDR "The Fala Speech"

FDR responds with good humor at Republican attempts to lay blame for the Great Depression at his doorstep. The president however takes exception to those who...

Teddy Roosevelt speech
Teddy Roosevelt speech

Theodore Roosevelt speech.

Franklin D Roosevelt - Dec. 8, 1941 "Day of Imfamy" Speech (Full Speech)
Franklin D Roosevelt - Dec. 8, 1941 "Day of Imfamy" Speech (Full Speech)

The complete speech delivered by FDR on Decemeber 8, 1941 to a joint session of Congress, asking for a declaration of war against Japan after the Pearl Harbo...

Teddy Roosevelt Speech on Social and Industrial Justice
Teddy Roosevelt Speech on Social and Industrial Justice

Actual speech recorded by my great-grandfather, of Teddy Roosevelt talking about the workers who are discriminated upon, and should be given more justices.

Franklin D. Roosevelt "Four Freedoms" Speech - January 6, 1941
Franklin D. Roosevelt "Four Freedoms" Speech - January 6, 1941

January 6, 1941: President Franklin Delano Roosevelt addresses a joint session of Congress in his "Four Freedoms" speech.

FDR D-Day Speech June 6, 1944
FDR D-Day Speech June 6, 1944

President Franklin D. Roosevelt speech on the eve of invasion of Normandy, June 06, 1944. Prevelant today.

FDR Nothing to Fear But Fear Itself 1933 Inaugural Address
FDR Nothing to Fear But Fear Itself 1933 Inaugural Address

Excerpt from first Inaugural Address of FDR.

World War II In HD Roosevelt Speech flv
World War II In HD Roosevelt Speech flv

Franklin D Roosevelt's speech after Pearl Harbor
Franklin D Roosevelt's speech after Pearl Harbor

Can you please tell all the people that you know about this video, I want everyone to understand this great time in history, which should never be forgotten!...

FDR's 1932 Presidential Campaign Speeches & Election | Franklin D. Roosevelt
FDR's 1932 Presidential Campaign Speeches & Election | Franklin D. Roosevelt

FDR's 1932 Presidential Campaign & Election | Franklin D. Roosevelt - SUBSCRIBE to Bright Enlightenment - JOIN the...

President Franklin D. Roosevelt - Declaration of War Address - "A Day Which Will Live in Infamy"
President Franklin D. Roosevelt - Declaration of War Address - "A Day Which Will Live in Infamy"

On December 8th, 1941, Franklin D. Roosevelt delivers his Declaration of War Address to congress. Excerpt taken from Great Speeches Vol. 5. from Educational ...

1912 US Election Campaign Speech Audio - Theodore Roosevelt 2 of 9
1912 US Election Campaign Speech Audio - Theodore Roosevelt 2 of 9

Scholars routinely observe that the advent of radio reshaped political speech. But for more than a decade before the first commercial radio broadcast station...

Franklin D. Roosevelt Speech (WW2 in HD Ending)
Franklin D. Roosevelt Speech (WW2 in HD Ending)

The Spirit of man has awakened The Soul of man has gone forth Grant us the wisdom and the vision to comprehend the greatness of man's Spirit that suffers and...

US President Franklin Roosevelt's "Great Arsenal of Democracy" speech. HD Stock Footage
US President Franklin Roosevelt's "Great Arsenal of Democracy" speech. HD Stock Footage

Link to order this clip: H...

Eleanor Roosevelt Speech Human Rights
Eleanor Roosevelt Speech Human Rights

Eleanor Roosevelt Speech Human Rights - FDR Presidential Library 1948 - Video 309 - Speech by Mrs. E. Roosevelt for a TV Program on Human Rights Day Archival...

Eleanor Roosevelt  Human Rights Speech
Eleanor Roosevelt Human Rights Speech

Speech by Mrs. Eleanor Roosevelt for a TV Program on Human Rights Day Archival footage from the FDR Presidential Library.

President Theodore Roosevelt on Liberty
President Theodore Roosevelt on Liberty

President Theodore Roosevelt speaking on Government and Liberty.

Franklin Delano Roosevelt - Pearl Harbor Address
Franklin Delano Roosevelt - Pearl Harbor Address

Franklin Delano Roosevelt giving the Pearl Harbor Address - "a date that will live in infamy"

FDR Second Bill of Rights Speech Footage
FDR Second Bill of Rights Speech Footage

This is FDR's proposed second Bill of Rights that was filmed after he delivered his State of the Union Address via radio on January 11, 1944.

The Four Freedoms - Franklin D. Roosevelt
The Four Freedoms - Franklin D. Roosevelt

Excerpt from United States President Franklin Delano Roosevelt's "State of the Union Address" to the 77th Congress, January 6, 1941. Pardon the quality, I sl...

Rough Riders (Teddy Roosevelt Speech)
Rough Riders (Teddy Roosevelt Speech)

Speech by Teddy Roosevelt (played by Tom Berenger)

President Franklin D. Roosevelt First Inaugural Address
President Franklin D. Roosevelt First Inaugural Address

President Franklin D. Roosevelt delivers his First Inaugural Address. Excerpt taken from Great Speeches Volume 5 from Educational Video Group, Inc. available...

1912 US Election Campaign Speech Audio - Theodore Roosevelt 1 of 9
1912 US Election Campaign Speech Audio - Theodore Roosevelt 1 of 9

Scholars routinely observe that the advent of radio reshaped political speech. But for more than a decade before the first commercial radio broadcast station...

Franklin D. Roosevelt Hitler New World Order Speech
Franklin D. Roosevelt Hitler New World Order Speech

This video has nothing to do with---------------------------disney illuminati freemason mason masonic edge eye nothing notilluminati farhank501 thefreemasonc...

Hitler Reichstag Speech Roosevelt
Hitler Reichstag Speech Roosevelt

The Anglo German Naval Agreement

First Lady Eleanor Roosevelt speech
First Lady Eleanor Roosevelt speech

First Lady Eleanor Roosevelt speech.

President Franklin Roosevelt 1933 Inauguration
President Franklin Roosevelt 1933 Inauguration Newsreel footage of President Franklin Delano Roosevelt's first inauguratio...

The best part of the movie "Pearl Harbor"
The best part of the movie "Pearl Harbor"

This scene is where the President Roosevelt (John Voight) is meeting with his defense cabinet to discuss plans for retaliation for the attack by the Japanese...

Franklin Roosevelt, "Quarantine" Speech (1937)
Franklin Roosevelt, "Quarantine" Speech (1937)

President Franklin Delano Roosevelt's famous "Quarantine" speech, on the need for an international "quarantine of the aggressor nations" (October 5th, 1937) ...

President Theodore Roosevelt - Man in the Arena Speech - 1910 - Hear the Full Text
President Theodore Roosevelt - Man in the Arena Speech - 1910 - Hear the Full Text

Listen to and read Citizenship in a Republic, also known as Man in the Arena, delivered at the Sorbonne in Paris on April 23, 1910, by U.S. President Theodor...

Theodore Roosevelt The Right of the People to Rule Speech
Theodore Roosevelt The Right of the People to Rule Speech - Teddy Roosevelt The Right of the People to Rule Speech.

First Lady Eleanor Roosevelt Address the United Nations and Carnegie Hall
First Lady Eleanor Roosevelt Address the United Nations and Carnegie Hall

Two Speeches By First Lady Eleanor Roosevelt (United Nations & Carnegie Hall). Excerpt taken from Great Speeches Volume 6 from Educational Video Group, Inc. ...

Churchill And Roosevelt Christmas Speech (1941)
Churchill And Roosevelt Christmas Speech (1941)

Unused / unissued material - dates unclear or unknown. Washington DC, United States of American (USA). View out from the White House. Dark shots from side of...

Theodore Roosevelt - Shall We Prepare?
Theodore Roosevelt - Shall We Prepare?

Summary Two sequences of TR: Sequence 1: views of TR walking onto the porch of Sagamore Hill, Oyster Bay, N.Y., facing the camera, and then speaking on milit...

Adolf Hitler reads Roosevelts letter before Reichstag
Adolf Hitler reads Roosevelts letter before Reichstag

President Roosevelt of the United States sent Adolf Hitler a letter where he asked him to not attack any of the following countries, half of the countries wh...

Franklin D. Roosevelt Inaugural Address - 1933 -
Franklin D. Roosevelt Inaugural Address - 1933 -

I'd would've loved to put the speech here in the Description box, but it kept telling me it couldn't be saved because it was to long.

Theodore Roosevelt on Big Business
Theodore Roosevelt on Big Business

An excerpt from a Theodore Roosevelt speech on his view, and the Progressive Party of 1912's view, of big business. This is a fairly typical expression of ea...

Watch Roosevelt Skerrit's final 2014 campaign speech
Watch Roosevelt Skerrit's final 2014 campaign speech

Watch a recording of Dominica Labour Party Political Leader, Prime Minister Roosevelt Skerrit's final 2014 campaign speech, at a rally in Castle Bruce, at th...

Eleanor Roosevelt Speech
Eleanor Roosevelt Speech

Teddy Roosevelt shot in chest, still gives 90 minute speech
Teddy Roosevelt shot in chest, still gives 90 minute speech

From episode 3 of "The Roosevelts: an Intimate Portrait."


True HD Direct Film Transfers - NO UPCONVERSIONS! Excerpts from President Franklin D. Roosevelt first...

Franklin D. Roosevelt inauguration address
Franklin D. Roosevelt inauguration address

Franklin D. Roosevelt's inauguration address.

Franklin Roosevelt's speech on Pearl Harbour Attack
Franklin Roosevelt's speech on Pearl Harbour Attack

F Roosevelt didn't want to be seen wheeled in a wheelchair. So he had to make a long walk to the podium. Very arduous for someone who really could not walk. ...

The Man in the Arena by Teddy Roosevelt (Great Speeches Series)
The Man in the Arena by Teddy Roosevelt (Great Speeches Series)

Theodore Roosevelt (he hated being called Teddy) delivered one of the most inspiring speeches, Citizenship in a Republic, in Paris in 1910. Teddy used his ph...

Related Producers: evgincforgottenhistoryusatimelessreader1koolbens1991storiesofusajujumediazonethebolshevikdragunovvarg555tothe666dizzo95cspanbritishpathelibraryofcongressbuyoutfootageiconicgMOji54PT5WMR-Xa52jW7gZdy5FLoKdjgmFKh21mG4pgameliagfrankctvalleyviewspeturbirureteralclock1917jw00534dominicalabourraymelendezkillwill3keepsake32744t56classicnewsclipszymurg2007paintankkodacodecbabrahamsonwordswithmeaningwararchivesa0WcamOL3nFwVAvbuuFXQAroxena1986fdrlibrarysultanknishforquignonperiscopefilmpublicresourceorgcriticalpastgeneralwasbrightenlightenmentisolatdincidentvktrsx

Find the Videos, Producers, & Vloggers You Want Faster