vidgrids.com : Online Video Search & Discovery Engine :

Saathiya Ahem Gopi Holi Videos

14 Gopi on Ahem's lap (Holi).flv
14 Gopi on Ahem's lap (Holi).flv

REMEMBERING GINAZ - GIA MANEK & MOHD NAZIM.

Saath Nibhaana Saathiya - 13th March 2012
Saath Nibhaana Saathiya - 13th March 2012

Jigar captures a photo of Aham and Gopi holding each other's hand. A group of drama actors come to Modi house and dance for Holi celebration. Aham and Gopi c...

Saath Nibhaana Saathiya - 12th June 2012
Saath Nibhaana Saathiya - 12th June 2012

Ahem apologizes to Gopi for not remembering their union on Holi day. He professes his love for her. Gopi is elated by his confession. Ahem admires Gopi while...

15 Romantic   Suhag raat   Title song 3
15 Romantic Suhag raat Title song 3

REMEMBERING GINAZ - GIA MANEK & MOHD NAZIM.

Saath Nibhaana Saathiya - 7th June 2012
Saath Nibhaana Saathiya - 7th June 2012

Rashi becomes concerned when Gopi feels giddy. Savita boasts to Kokila that her daughter-in-law is pregnant. Ahem thanks Gopi for saving his life. He thinks ...

Ahem & Gopi's RAINY ROMANTIC SEQUENCE in Saath Nibhana Saathiya 9th July 2012
Ahem & Gopi's RAINY ROMANTIC SEQUENCE in Saath Nibhana Saathiya 9th July 2012

The viewers of Saath Nibhana Saathiya have already witnessed sad moments and issues related to Gopi's pregnancy till now. Gopi meets with an accident while s...

Ahem & Gopi FINALLY TOGETHER in Star Plus Saath Nibhana Saathiya 14th March 2014 FULL EPISODE
Ahem & Gopi FINALLY TOGETHER in Star Plus Saath Nibhana Saathiya 14th March 2014 FULL EPISODE

Hey guys, telebuzz brings to you updates on Ahem and Gopi's Saath Nibhana Saathiya on star plus. In 14th March 2014 Episode you will see that now Ahem and Go...

Saath Nibhaana Saathiya - 1st April 2014 : Ep 1050
Saath Nibhaana Saathiya - 1st April 2014 : Ep 1050

In episode 1050 of Saath Nibhaana Saathiya, aired on 1st April 2014, Urmila and Rashi decide to serve bhang to Ahem Gopi wishes Radha on the occasion of Holi...

Gopi and Ahem eyelock coming up holi episodes SBB spoiler
Gopi and Ahem eyelock coming up holi episodes SBB spoiler

After Rashi is saved Ahem gives his jacket to Gopi and Both have a eyelock coming up episodes of holika dehan of #saathiya just gohem/ devna bit from SBB seg...

9 Ahem wants to put holi on Gopi
9 Ahem wants to put holi on Gopi

REMEMBERING GINAZ - GIA MANEK & MOHD NAZIM.

SAATH NIBHANA SATHIYA -- AHEM MEETS OLD GOPI BAHU
SAATH NIBHANA SATHIYA -- AHEM MEETS OLD GOPI BAHU

NAZIM MEETS JIYA MANEK AT JINI JUJU SET.

NEW ROMANTIC TWIST  in Ahem & Gopis's LIFE in Saath Nibhana Saathiya 14th April 2014 FULL EPISODE
NEW ROMANTIC TWIST in Ahem & Gopis's LIFE in Saath Nibhana Saathiya 14th April 2014 FULL EPISODE

Telebuzz brings to some latest updates in Ahem & Gopi's Saath Nibhana Saathiya on Star Plus. In 14th April 2014 Episode you will see shocking twists and turn...

Saath Nibhaana Saathiya - Ahem behaves Nice With Gopi
Saath Nibhaana Saathiya - Ahem behaves Nice With Gopi

Ahem acts nice towards Gopi. He said her that he will be back home soon, to impress Nani. Everyone cheers up. StarPlus.StarTv.in.

Saath Nibhaana Saathiya : Ahem, Gopi and Her Lover
Saath Nibhaana Saathiya : Ahem, Gopi and Her Lover

Saath Nibhaana Saathiya : Ahem, Gopi and Her Lover. Saath Nibhana Saathiya is the story of two cousins — Gopi and Rashi — who are complete opposites. Gopi is...

Gopi & Ahem FINALLY MEET after 6 years in Saath Nibhana Saathiya 17th February 2014 FULL EPSIODE
Gopi & Ahem FINALLY MEET after 6 years in Saath Nibhana Saathiya 17th February 2014 FULL EPSIODE

Hey guys , telebuzz is back with some new updates on the evergreen show Saath Nibana Saathiya. The wait is finally over for all fans of Ahem and Gopi, as the...

Saath Nibhaana Saathiya - 31st March 2014 : Ep 1049
Saath Nibhaana Saathiya - 31st March 2014 : Ep 1049

In episode 1049 of Saath Nibhaana Saathiya, aired on 31st March 2014, Jigar wishes Rashi on the occasion of Holi Ahem refuses to accept Gopi as his wife. Gop...

Gopi slaps Ahem in 'Saathiya'
Gopi slaps Ahem in 'Saathiya'

Saath Nibhaana Saathiya - 1st August 2013 : Ep 869
Saath Nibhaana Saathiya - 1st August 2013 : Ep 869

In episode 869 of Saath Nibhaana Saathiya, aired on 1st August 2013, Radha dresses in Gopi's clothes Gopi becomes worried as her phone falls into the water. ...

Gopi & Ahem's SHOCKING MARRIAGE AGAIN in Saath Nibhana Saathiya 26th February 2014 FULL EPISODE
Gopi & Ahem's SHOCKING MARRIAGE AGAIN in Saath Nibhana Saathiya 26th February 2014 FULL EPISODE

The couple Ahem and Gopi have been separated for long in the show Saath Nibhana Saathiya, but now, the family will see some happy time with the couple coming...

Gopi & Ahem's TOGETHERNESS ONCE AGAIN in Saath Nibhana Saathiya 9th April 2014 FULL EPISODE
Gopi & Ahem's TOGETHERNESS ONCE AGAIN in Saath Nibhana Saathiya 9th April 2014 FULL EPISODE

Telebuzz is back with some latest updates on Saath Nibhana Saathiya. In 9th April 2014 Episode you will see Gopi & ahem'd togetherness once again. Click here...

Gopi Ahem FINALLY FIND Vidya & NEW TRACK in Saath Nibhana Saathiya 13th March 2014 FULL EPISODE
Gopi Ahem FINALLY FIND Vidya & NEW TRACK in Saath Nibhana Saathiya 13th March 2014 FULL EPISODE

Hey guys, telebuzz is back with some latest updates on star plus Saath Nibhana Saathiya. In 13th March 2014 Episode you will that gopi and ahem finally find ...

saath nibhana saathiya 12th june 2012
saath nibhana saathiya 12th june 2012

Ahem confess his love to gopi and gopi thanks kanaji.

28 Ahem speaks to Gopi abt his holi confusion
28 Ahem speaks to Gopi abt his holi confusion

REMEMBERING GINAZ - GIA MANEK & MOHD NAZIM.

Gopi TO LEAVE Modi House & Ahem in Saath Nibhana Saathiya 13th March 2014 FULL EPISODE
Gopi TO LEAVE Modi House & Ahem in Saath Nibhana Saathiya 13th March 2014 FULL EPISODE

Hey guys, telebuzz is back with some latest updates on Star plus Saath Nibhana Saathiya. In 13th March 2014 Episode you will see Gopi to leave modi house and...

Kokila TO GET BACK her MEMORY in Ahem & Gopi's Saath Nibhana Saathiya 16th April 2014 FULL EPISODE
Kokila TO GET BACK her MEMORY in Ahem & Gopi's Saath Nibhana Saathiya 16th April 2014 FULL EPISODE

Telebuzz is back with some latest updates on Ahem & Gopi's Saath Nibhana Saathiya on Star Plus. In 16th April 2014 Episode you will see Kokila to get back he...

Gopi And Ahem scenes on full Saathiya title song.wmv
Gopi And Ahem scenes on full Saathiya title song.wmv

Gopi and Ahem scenes from 8th September.

Gopi TO FIGHT With FIRE in Ahem & Gopi's Saath Nibhana Saathiya 28th March 2014 FULL EPISODE
Gopi TO FIGHT With FIRE in Ahem & Gopi's Saath Nibhana Saathiya 28th March 2014 FULL EPISODE

Telebuzz brings to you latest updates on evergreen show of star plus Saath Nibhana Saathiya... In 20th march 2014 Episode you will see ahem and gopi to fight...

Saath Nibhaana Saathiya : Ahem and Gopi find out Gauri's truth
Saath Nibhaana Saathiya : Ahem and Gopi find out Gauri's truth

Ahem and Gopi break into tears of joy on learning about Gauri's truth. But what is the truth? To find out, stay tuned to 'Saath Nibhaana Saathiya', from Mond...

12 Ahem wishes Gopi Happy Holi
12 Ahem wishes Gopi Happy Holi

REMEMBERING GINAZ - GIA MANEK & MOHD NAZIM.

Ahem And Gopi GET INTIMATE In Saath Nibhana Saathiya 10th April Full Episode HD
Ahem And Gopi GET INTIMATE In Saath Nibhana Saathiya 10th April Full Episode HD

Watch the full video to know more!

GoHem(Gopi and Ahem) dance as Radha Krishna in janmastami special play
GoHem(Gopi and Ahem) dance as Radha Krishna in janmastami special play

GoHem dance as Radha Krishna in Janmastami play beautiful moment HQ No Copyright is infrigmented the clip belongs to the respectivechannel and PH we donot ow...

Radha TO KILL Ahem & Gopi's MEERA in Saath Nibhana Saathiya 2nd May 2014 FULL EPISODE HD
Radha TO KILL Ahem & Gopi's MEERA in Saath Nibhana Saathiya 2nd May 2014 FULL EPISODE HD

Telebuzz is back with some latest updates on Saath Nibhana Saathiya on Star Plus. In 2nd May 2014 Episode you will see radh to kill ahem & gopi's gauri/ Meer...

Saath Nibhaana Saathiya - 19th December 2012
Saath Nibhaana Saathiya - 19th December 2012

The Modi family worries about Kokila's deteriorating health. Dhaval and Urmila comfort them. Meanwhile, the women passengers in the bus aid Gopi in deliverin...

Gopi and Ahem scene from 30th April 2012 Ahem kiss Gopi
Gopi and Ahem scene from 30th April 2012 Ahem kiss Gopi

Gopi gets KIDNAPPED in Ahem & Gopi's Saath Nibhana Saathiya 28th March 2014 FULL EPISODE
Gopi gets KIDNAPPED in Ahem & Gopi's Saath Nibhana Saathiya 28th March 2014 FULL EPISODE

Telebuzz is back with some latest updates on Ahem and Gopi's Saath Nibhana Saathiya on Star Plus. In 28th March 2014 Episode , you will see Gopi To get kidna...

Saath Nibhaana Saathiya - 7th June 2012
Saath Nibhaana Saathiya - 7th June 2012

Rashi becomes concerned when Gopi feels giddy. Savita boasts to Kokila that her daughter-in-law is pregnant. Ahem thanks Gopi for saving his life. He thinks ...

Saath Nibhaana Saathiya - 5th June 2012
Saath Nibhaana Saathiya - 5th June 2012

Ahem condemns Anita for planning to harm Gopi. He tells her that he does not love her and that he is happy with Gopi, his wife. Kokila tells Anita to stay aw...

Meera & Vidya GET KIDNAPPED  Ahem & Gopi's Saath Nibhana Saathiya 25th April 2014 FULL EPISODE HD
Meera & Vidya GET KIDNAPPED Ahem & Gopi's Saath Nibhana Saathiya 25th April 2014 FULL EPISODE HD

Telebuzz is back with some latest updates on Ahem & Gopi's Saath Nibhana Saathiya on Star Plus. In 25th April 2014 Episode you will see Meera & Vidya To get ...

DevNa|GoHem- Gopi- Ahem Good night Kiss Scene, story telling Scene
DevNa|GoHem- Gopi- Ahem Good night Kiss Scene, story telling Scene

DevNa #GoHem #Gopi #Ahem #GoodNightKiss Beautiful moment GoHem are in the room before sleeping when kids call Gopi ji and tell her that they cant sleep so o...

Ahem And Gopi To Be SEPARATED On SAATH NIBHANA SAATHIYA 21st July Full Episode Update
Ahem And Gopi To Be SEPARATED On SAATH NIBHANA SAATHIYA 21st July Full Episode Update

Subscribe to our channel TeleFever for the latest Television News and Gossip. Facebook: https://facebook.com/TeleFever Twitter: https://twitter.com/gossi...

Saathiya's Gopi and Ahem spend sleepless night
Saathiya's Gopi and Ahem spend sleepless night

DevNa|GoHem Gopi-AHem's dance on Salame Ishq (romantic)
DevNa|GoHem Gopi-AHem's dance on Salame Ishq (romantic)

When Gopi and Ahem danced on Salame Ishq for their lovely daughter Meera's dolls wedding very short moment Edited version extras removed and gohem frames add...

Saath Nibhaana Saathiya - 19th July 2013 : Ep 860
Saath Nibhaana Saathiya - 19th July 2013 : Ep 860

In episode 860 of Saath Nibhaana Saathiya, aired on 19th July 2013, Gopi's mother slaps Ahem Urmila overhears Kinjal talking on the phone, and suspects her o...

Saathiya New promo for 15th May Gopi and AHem (gohem/devna)hugknowing about Meera
Saathiya New promo for 15th May Gopi and AHem (gohem/devna)hugknowing about Meera

Saathiya New promo for 15th May Gopi and AHem (gohem/devna)hugknowing about Meera.... No copyright infrigement is intended Video belongs to the respective ow...

Gopi TO IMPRESS Ahem & Family in Saath Nibhana Saathiya 24th March 2014 FULL EPISODE
Gopi TO IMPRESS Ahem & Family in Saath Nibhana Saathiya 24th March 2014 FULL EPISODE

Telebuzz brings to you some latest updates on Star Plus' Popular show Saath Nibhana Saathiya. In 24th March 2014 Episode you will see Gopi to impress ahem an...

Saath Nibhaana Saathiya - 11th March 2014 : Ep 1032
Saath Nibhaana Saathiya - 11th March 2014 : Ep 1032

In episode 1032 of Saath Nibhaana Saathiya, aired on 11th March 2014, Ahem remarries Gopi Gopi becomes unconscious on consuming the drink. Rashi takes Gopi t...

Saath Nibhaana Saathiya - 16th April 2013 : Ep 792
Saath Nibhaana Saathiya - 16th April 2013 : Ep 792

In episode 792 of Saath Nibhaana Saathiya, aired on 16th April 2013, Ahem saves Meera from the mad woman Ahem disguises as Gopi to trick the mad woman and sa...

Saath Nibhana Saathiya | Ahem To Marry Gopi's Sister Radha
Saath Nibhana Saathiya | Ahem To Marry Gopi's Sister Radha

Saath Nibhana Saathiya | Ahem To Marry Gopi's Sister Radha - In the upcoming episodes, gear up to see the Modi family trying to get Ahem and Radha (Bhavini P...

Related Producers: telebuzzstarplusdevnafcnew2u1000abpnewstvtelefevertellytweetssidma4lyfthesunny90008delhincrnowaadis83sabfake4QkmtjChCdS2O3ahZiadv9Q

Find the Videos, Producers, & Vloggers You Want Faster